PDB entry 1zab

View 1zab on RCSB PDB site
Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with 3-Deazauridine
Class: hydrolase
Keywords: mouse, cytidine deaminase, zinc, 3-deazauridine, substrate dissociation, HYDROLASE
Deposited on 2005-04-06, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.176
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zaba1
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zabb_
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zabc_
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zabd_
  • Heterogens: ZN, SO4, URD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zabA (A:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zabA (A:)
    vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
    aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
    qellpasfgpedlqkiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zabB (B:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zabB (B:)
    vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
    aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
    qellpasfgpedlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zabC (C:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zabC (C:)
    avepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaer
    taiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrt
    vqellpasfgpedlqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zabD (D:)
    maqerpscavepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacy
    plgvcaertaiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkp
    dgtfvvrtvqellpasfgpedlqkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zabD (D:)
    vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
    aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
    qellpasfgpedlqkiq