PDB entry 1zaa

View 1zaa on RCSB PDB site
Description: zinc finger-DNA recognition: crystal structure of a zif268-DNA complex at 2.1 angstroms
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1992-09-17, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3')
  • Chain 'C':
    Compound: protein (zif268)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zaac1, d1zaac2, d1zaac3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zaaC (C:)
    herpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
    kpfacdicgrkfarsderkrhtkihlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zaaC (C:)
    rpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
    facdicgrkfarsderkrhtkihlr