PDB entry 1za8

View 1za8 on RCSB PDB site
Description: NMR solution structure of a leaf-specific-expressed cyclotide vhl-1
Deposited on 2005-04-05, released 2005-04-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vhl-1
    Species: Viola hederacea [TaxId:180952]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1za8A (A:)
    cgescamisfcftevigcscknkvcylnsis