PDB entry 1za6

View 1za6 on RCSB PDB site
Description: The structure of an antitumor CH2-domain-deleted humanized antibody
Class: immune system
Keywords: Immunoglobulin fold, CH2-domain-deletion, IMMUNE SYSTEM
Deposited on 2005-04-05, released 2005-05-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.246
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGG Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: IGG Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1za6b1, d1za6b2, d1za6b3
  • Chain 'C':
    Compound: IGG Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: IGG Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1za6d1, d1za6d2, d1za6d3
  • Chain 'E':
    Compound: IGG Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: IGG Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1za6f1, d1za6f2, d1za6f3
  • Chain 'G':
    Compound: IGG Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: IGG Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1za6h1, d1za6h2, d1za6h3

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1za6B (B:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthtcppcgggssgggsggqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za6B (B:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscqprepqvytlppsrdeltknqv
    sltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvf
    scsvmhealhnhytqkslslspgk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1za6D (D:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthtcppcgggssgggsggqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za6D (D:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscqprepqvytlppsrdeltknqv
    sltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvf
    scsvmhealhnhytqkslslspgk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1za6F (F:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthtcppcgggssgggsggqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za6F (F:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscqprepqvytlppsrdeltknqv
    sltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvf
    scsvmhealhnhytqkslslspgk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1za6H (H:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthtcppcgggssgggsggqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za6H (H:)
    qvqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfky
    nerfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscqprepqvytlppsrdeltknqv
    sltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvf
    scsvmhealhnhytqkslslspgk