PDB entry 1za5

View 1za5 on RCSB PDB site
Description: Q69H-FeSOD
Class: oxidoreductase
Keywords: H-bonding redox tuning superoxide dismutase proton-coupled electron transfer, oxidoreductase
Deposited on 2005-04-05, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Gene: sodB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3
      • engineered (68)
    Domains in SCOPe 2.07: d1za5a1, d1za5a2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Gene: sodB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered (68)
    Domains in SCOPe 2.07: d1za5b1, d1za5b2
  • Heterogens: FE, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1za5A (A:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaahvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1za5B (B:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaahvwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa