PDB entry 1za4

View 1za4 on RCSB PDB site
Description: Crystal Structure of the Thrombospondin-1 N-terminal Domain in Complex with Arixtra
Class: cell adhesion
Keywords: tsp-1, ntsp-1, hbd, arixtra
Deposited on 2005-04-05, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin 1
    Species: HOMO SAPIENS
    Gene: THBS1, TSP, TSP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07996 (Start-218)
      • modified residue (82)
      • modified residue (159)
    Domains in SCOP 1.73: d1za4a1
  • Heterogens: SGN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1za4A (A:)
    rspwnripesggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddk
    fqdlvdavrtekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltv
    qgkqhvvsveeallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasi
    arlriakggvndnfqgvlqnvrfvfgttpedilrnkgcssstsvlltldnnvvngsspai
    rtntghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1za4A (A:)
    svfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgf
    lllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveeall
    atgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnf
    qgvlqnvrfvfgttpedilrnkgcs