PDB entry 1z9x

View 1z9x on RCSB PDB site
Description: human drp-1 kinase, w305s s308a d40 mutant, crystal form with 3 monomers in the asymmetric unit
Deposited on 2005-04-05, released 2006-10-24
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.93 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • variant (231)
      • variant (243)
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • variant (231)
      • variant (243)
  • Chain 'C':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • variant (231)
      • variant (243)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z9xA (A:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1z9xA (A:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z9xB (B:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1z9xB (B:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1z9xC (C:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1z9xC (C:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr