PDB entry 1z9v

View 1z9v on RCSB PDB site
Description: Solution Structure of MTH0776 from Methanobacterium thermoautotrophicum (strain H)
Deposited on 2005-04-04, released 2005-11-22
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein MTH0776
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: MTH776
    Database cross-references and differences (RAF-indexed):
    • GB AAB85279 (20-120)
      • cloning artifact (19)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z9vA (A:)
    mgsshhhhhhssglvprgshmtfcletylqqsgeyeihmkragfrecaamiekkarrvvh
    ikpgekilgariigippvpigideerstvmipytkpcygtavvelpvdpeeierilevae
    p
    

    Sequence, based on observed residues (ATOM records):
    >1z9vA (A:)
    hmtfcletylqqsgeyeihmkragfrecaamiekkarrvvhikpgekilgariigippvp
    igideerstvmipytkpcygtavvelpvdpeeierilevaep