PDB entry 1z9u

View 1z9u on RCSB PDB site
Description: Structural Genomics, The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium
Class: transferase
Keywords: acetyl transferase, L7/L12, Salmonella typhimurium, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-04-04, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: GI:16764955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9ua_
  • Chain 'B':
    Compound: acetyl transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: GI:16764955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z9ub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9uA (A:)
    mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
    lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
    yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9uA (A:)
    eiipvsttlelraadeshvpalhqlvlknkawlqqsldqytsqeetrkhvqgnillhqrg
    yakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrg
    dirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z9uB (B:)
    mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
    lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
    yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9uB (B:)
    veiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnill
    hqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthy
    arrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid