PDB entry 1z9t

View 1z9t on RCSB PDB site
Description: crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution
Class: oxidoreductase
Keywords: putative laccase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, oxidoreductase
Deposited on 2005-04-04, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.143
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0124 protein yfiH
    Species: Escherichia coli [TaxId:562]
    Gene: YfiH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33644 (Start-254)
      • modified residue (114)
      • modified residue (184)
      • modified residue (247)
    Domains in SCOPe 2.07: d1z9ta_
  • Heterogens: CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9tA (A:)
    mgsdkihhhhhhmsklivpqwpqpkgvaacsstriggvslppydslnlgahcgdnpdhve
    enrkrlfaagnlpskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadcl
    pvlfcnragtevaaahagwrglcagvleetvscfadnpenilawlgpaigprafevggev
    reafmavdakasaafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyr
    rdkttgrmasfiwli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9tA (A:)
    sklivpqwpqpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlp
    skpvwleqvhgkdvlkltgyaskradasysntpgtvcavmtadclpvlfcnragtevaaa
    hagwrglcagvleetvscfadnpenilawlgpaigprafevggevreafmavdakasaaf
    iqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiwli