PDB entry 1z9s

View 1z9s on RCSB PDB site
Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex
Class: chaperone/immune system
Keywords: donor strand complementation, native minimal fiber, chaperone-usher pathway, chaperone/immune system complex
Deposited on 2005-04-04, released 2005-06-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z9sa1, d1z9sa2
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: CAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z9sb1
  • Chain 'C':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: CAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z9sc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9sA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9sA (A:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekpfvvtpplfrlda
    kqqnslriaqaggvfprdkeslkwlcvkgippdvgvfvqfainncikllvrpnelkgtpi
    qfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlarnvswri
    indqggldrlysknvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z9sB (B:)
    adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z9sC (C:)
    adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9sC (C:)
    itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
    gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
    vtvtvsnq