PDB entry 1z9q

View 1z9q on RCSB PDB site
Description: Solution structure of SH3 domain of p40phox
Class: Oxidoreductase Activator
Keywords: Oxidoreductase Activator
Deposited on 2005-04-04, released 2006-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z9qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9qA (A:)
    mnhkvhhhhhhhmdrmaapraealfdftgnsklelnfkagdvifllsrinkdwlegtvrg
    atgifplsfvkilkdfpee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9qA (A:)
    drmaapraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkil
    kdfpee