PDB entry 1z9o

View 1z9o on RCSB PDB site
Description: 1.9 Angstrom Crystal Structure of the Rat VAP-A MSP Homology Domain in Complex with the Rat ORP1 FFAT Motif
Deposited on 2005-04-03, released 2005-07-19
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'B':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'C':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'D':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'E':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'F':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • GB NP_113819 (Start-127)
  • Chain 'G':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Oxysterol binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z9oA (A:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oA (A:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z9oB (B:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oB (B:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1z9oC (C:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oC (C:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1z9oD (D:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oD (D:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1z9oE (E:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oE (E:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1z9oF (F:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9oF (F:)
    eqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsgvidpg
    sivtvsvmlqpfdydpnekskhkfmvqtifappsdmeavwkeakpdelmdsklrcvfem
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1z9oG (G:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oG (G:)
    edefydals
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1z9oH (H:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oH (H:)
    edefydals
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1z9oI (I:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oI (I:)
    edefydals
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1z9oJ (J:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oJ (J:)
    edefydals
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1z9oK (K:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oK (K:)
    edefydals
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1z9oL (L:)
    sedefydals
    

    Sequence, based on observed residues (ATOM records):
    >1z9oL (L:)
    edefydals