PDB entry 1z9m

View 1z9m on RCSB PDB site
Description: Crystal Structure of Nectin-like molecule-1 protein Domain 1
Deposited on 2005-04-03, released 2006-02-07
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gapa225
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAQ88698
  • Chain 'B':
    Compound: gapa225
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAQ88698
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z9mA (A:)
    gsgmketaaakferqhmdspdlgtddddkamadinlsqddsqpwtsdetvvaggtvvlkc
    qvkdhedsslqwsnpaqqtlyfgekralrdnriqlvtstphelsisisnvaladegeytc
    siftmpvrtakslvtvlgipqkpii
    

    Sequence, based on observed residues (ATOM records):
    >1z9mA (A:)
    qddsqpwtsdetvvaggtvvlkcqvkdhedsslqwsnpaqqtlyfgekralrdnriqlvt
    stphelsisisnvaladegeytcsiftmpvrtakslvtvlgipq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z9mB (B:)
    gsgmketaaakferqhmdspdlgtddddkamadinlsqddsqpwtsdetvvaggtvvlkc
    qvkdhedsslqwsnpaqqtlyfgekralrdnriqlvtstphelsisisnvaladegeytc
    siftmpvrtakslvtvlgipqkpii
    

    Sequence, based on observed residues (ATOM records):
    >1z9mB (B:)
    sqddsqpwtsdetvvaggtvvlkcqvkdhedsslqwsnpaqqtlyfgekralrdnriqlv
    tstphelsisisnvaladegeytcsiftmpvrtakslvtvlgipq