PDB entry 1z9l

View 1z9l on RCSB PDB site
Description: 1.7 Angstrom Crystal Structure of the Rat VAP-A MSP Homology Domain
Deposited on 2005-04-03, released 2005-07-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z270 (3-127)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (74)
      • modified residue (91)
      • modified residue (104)
      • modified residue (117)
      • modified residue (127)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z9lA (A:)
    gshmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpn
    sgvidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmds
    klrcvfem
    

    Sequence, based on observed residues (ATOM records):
    >1z9lA (A:)
    hmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprrycvrpnsg
    vidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpdelmdskl
    rcvfem