PDB entry 1z9f

View 1z9f on RCSB PDB site
Description: Crystal structure of single stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution
Class: DNA binding protein
Keywords: TM0604, single stranded DNA-binding protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, DNA BINDING PROTEIN
Deposited on 2005-04-01, released 2005-04-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.231
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ73 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.05: d1z9fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9fA (A:)
    mgsdkihhhhhhmsffnkiiligrlvrdpeerytlsgtpvttftiavdrvprknapddaq
    ttdffrivtfgrlaefartyltkgrlvlvegemrmrrwetptgekrvspevvanvvrfmd
    rkpaetvseteeeleipeedfssdtfsedeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9fA (A:)
    hmsffnkiiligrlvrdpeerytltpvttftiavdrttdffrivtfgrlaefartyltkg
    rlvlvegemrmrrkrvspevvanvvrfmd