PDB entry 1z9d

View 1z9d on RCSB PDB site
Description: Crystal structure of a putative uridylate kinase (UMP-kinase) from Streptococcus pyogenes
Class: transferase
Keywords: Structural Genomics; Protein Structure Initiative; NYSGXRC; T1668; pyrH; putative uridylate kinase, UMP-kinase, PSI, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2005-04-01, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: pyrH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65938 (3-End)
      • modified residue (68)
      • modified residue (78)
      • modified residue (83)
      • modified residue (88)
      • modified residue (107)
      • modified residue (160)
      • modified residue (198)
      • modified residue (207)
      • modified residue (218)
    Domains in SCOPe 2.07: d1z9da1
  • Chain 'B':
    Compound: uridylate kinase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: pyrH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65938 (3-End)
      • modified residue (68)
      • modified residue (78)
      • modified residue (83)
      • modified residue (88)
      • modified residue (107)
      • modified residue (160)
      • modified residue (198)
      • modified residue (207)
      • modified residue (218)
    Domains in SCOPe 2.07: d1z9db_
  • Chain 'C':
    Compound: uridylate kinase
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: pyrH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65938 (3-End)
      • modified residue (68)
      • modified residue (78)
      • modified residue (83)
      • modified residue (88)
      • modified residue (107)
      • modified residue (160)
      • modified residue (198)
      • modified residue (207)
      • modified residue (218)
    Domains in SCOPe 2.07: d1z9dc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9dA (A:)
    mslepkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwr
    gepaadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgra
    lrhleknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdana
    vkfdelthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsn
    kvcdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9dA (A:)
    epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
    aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
    leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
    delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z9dB (B:)
    mslepkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwr
    gepaadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgra
    lrhleknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdana
    vkfdelthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsn
    kvcdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9dB (B:)
    epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
    aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
    leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
    delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z9dC (C:)
    mslepkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwr
    gepaadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgra
    lrhleknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdana
    vkfdelthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsn
    kvcdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9dC (C:)
    epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
    aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
    leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
    delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk