PDB entry 1z9c

View 1z9c on RCSB PDB site
Description: Crystal structure of OhrR bound to the ohrA promoter: Structure of MarR family protein with operator DNA
Class: transcription/DNA
Keywords: OhrR, MarR family protein, bacterial transcription factor, Winged HTH protein, TRANSCRIPTION/DNA COMPLEX
Deposited on 2005-04-01, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9ca_
  • Chain 'B':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9cb_
  • Chain 'C':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9cc_
  • Chain 'D':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9cd_
  • Chain 'E':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9ce_
  • Chain 'F':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z9cf_
  • Chain 'G':
    Compound: DNA (29-mer)
  • Chain 'H':
    Compound: DNA (29-mer)
  • Chain 'I':
    Compound: DNA (29-mer)
  • Chain 'J':
    Compound: DNA (29-mer)
  • Chain 'K':
    Compound: DNA (29-mer)
  • Chain 'L':
    Compound: DNA (29-mer)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9cA (A:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cA (A:)
    klenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlylds
    gtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsged
    lkqlksalytlletlhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z9cB (B:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cB (B:)
    mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
    sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
    dlkqlksalytlletlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z9cC (C:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cC (C:)
    hmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyl
    dsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsg
    edlkqlksalytlletlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z9cD (D:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cD (D:)
    mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
    sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
    dlkqlksalytlletlh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z9cE (E:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cE (E:)
    mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
    sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
    dlkqlksalytlletlh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z9cF (F:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9cF (F:)
    hmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyl
    dsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsg
    edlkqlksalytlletlh
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.