PDB entry 1z9b

View 1z9b on RCSB PDB site
Description: Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
Deposited on 2005-04-01, released 2005-08-30
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-2
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: infB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04766 (14-134)
      • cloning artifact (0-13)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z9bA (A:)
    nefelgtrgssrvdlqeqrsvktrvslddlfeqikqgemkelnlivkadvqgsvealvaa
    lqkidvegvrvkiihaavgaitesdislatasnaivigfnvrpdanakraaesekvdirl
    hriiynvieeieaam