PDB entry 1z99

View 1z99 on RCSB PDB site
Description: Solution structure of Crotamine, a myotoxin from Crotalus durissus terrificus
Class: toxin
Keywords: beta-defensin-fold, myotoxin
Deposited on 2005-04-01, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crotamine
    Species: Crotalus durissus terrificus [TaxId:8732]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z99A (A:)
    ykqchkkgghcfpkekiclppssdfgkmdcrwrwkcckkgsg