PDB entry 1z98

View 1z98 on RCSB PDB site
Description: Crystal structure of the spinach aquaporin SoPIP2;1 in a closed conformation
Class: transport protein,membrane protein
Keywords: integral membrane protein; pip; alpha-helical; aquaporin, transport protein,membrane protein
Deposited on 2005-04-01, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aquaporin
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z98a_
  • Chain 'M':
    Compound: aquaporin
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z98m_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z98A (A:)
    mskevseeaqahqhgkdyvdpppapffdlgelklwsfwraaiaefiatllflyitvatvi
    ghsketvvcgsvgllgiawafggmifvlvyctagisgghinpavtfglflarkvsllral
    vymiaqclgaicgvglvkafmkgpynqfgggansvalgynkgtalgaeiigtfvlvytvf
    satdpkrsardshvpilaplpigfavfmvhlatipitgtginparsfgaavifnsnkvwd
    dqwifwvgpfigaavaaayhqyvlraaaikalgsfrsnptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z98A (A:)
    apffdlgelklwsfwraaiaefiatllflyitvatvighsketvvcgsvgllgiawafgg
    mifvlvyctagisgghinpavtfglflarkvsllralvymiaqclgaicgvglvkafmkg
    pynqfgggansvalgynkgtalgaeiigtfvlvytvfsatdpkrsardshvpilaplpig
    favfmvhlatipitgtginparsfgaavifnsnkvwddqwifwvgpfigaavaaayhqyv
    lraaaikalgs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1z98M (M:)
    mskevseeaqahqhgkdyvdpppapffdlgelklwsfwraaiaefiatllflyitvatvi
    ghsketvvcgsvgllgiawafggmifvlvyctagisgghinpavtfglflarkvsllral
    vymiaqclgaicgvglvkafmkgpynqfgggansvalgynkgtalgaeiigtfvlvytvf
    satdpkrsardshvpilaplpigfavfmvhlatipitgtginparsfgaavifnsnkvwd
    dqwifwvgpfigaavaaayhqyvlraaaikalgsfrsnptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z98M (M:)
    apffdlgelklwsfwraaiaefiatllflyitvatvighsketvvcgsvgllgiawafgg
    mifvlvyctagisgghinpavtfglflarkvsllralvymiaqclgaicgvglvkafmkg
    pynqfgggansvalgynkgtalgaeiigtfvlvytvfsatdpkrsardshvpilaplpig
    favfmvhlatipitgtginparsfgaavifnsnkvwddqwifwvgpfigaavaaayhqyv
    lraaaikalgs