SCOP 1.75: Structural Classification of Proteins

PDB entry 1z96

View 1z96 on RCSB PDB site
Description: Crystal structure of the Mud1 UBA domain
Class: protein transport
Keywords: UBA, ubiquitin, three-helix bundle
Deposited on 2005-03-31, released 2005-10-04
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: UBA-domain protein mud1
Species: Schizosaccharomyces pombe
Gene: mud1
Database cross-references and differences (RAF-indexed):
- Uniprot Q10256 (Start-39)
Domains in SCOP 1.75: d1z96a1
Chain 'B':
Compound: UBA-domain protein mud1
Species: Schizosaccharomyces pombe
Gene: mud1
Database cross-references and differences (RAF-indexed):
- Uniprot Q10256 (Start-39)
Domains in SCOP 1.75: d1z96b1
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)
```
>1z96A (A:)
dpglnskiaqlvsmgfdpleaaqaldaangdldvaasfll
```
Sequence, based on observed residues (ATOM records): (download)
```
>1z96A (A:)
glnskiaqlvsmgfdpleaaqaldaangdldvaasfll
```
Chain 'B':
Sequence, based on SEQRES records: (download)
```
>1z96B (B:)
dpglnskiaqlvsmgfdpleaaqaldaangdldvaasfll
```
Sequence, based on observed residues (ATOM records): (download)
```
>1z96B (B:)
skiaqlvsmgfdpleaaqaldaangdldvaasfll
```