PDB entry 1z96

View 1z96 on RCSB PDB site
Description: Crystal structure of the Mud1 UBA domain
Class: protein transport
Keywords: UBA, ubiquitin, three-helix bundle, PROTEIN TRANSPORT
Deposited on 2005-03-31, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBA-domain protein mud1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: mud1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z96a1
  • Chain 'B':
    Compound: UBA-domain protein mud1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: mud1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z96b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z96A (A:)
    dpglnskiaqlvsmgfdpleaaqaldaangdldvaasfll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z96A (A:)
    glnskiaqlvsmgfdpleaaqaldaangdldvaasfll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z96B (B:)
    dpglnskiaqlvsmgfdpleaaqaldaangdldvaasfll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z96B (B:)
    skiaqlvsmgfdpleaaqaldaangdldvaasfll