PDB entry 1z94

View 1z94 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.
Class: structural genomics, unknown function
Keywords: hypothetical protein, NESG, CV1439, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-03-31, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94a1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36 (0-End)
      • modified residue (0)
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94b_
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94c_
  • Chain 'D':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94d_
  • Chain 'E':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94e_
  • Chain 'F':
    Compound: conserved hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NY36
      • modified residue (53)
      • modified residue (94)
    Domains in SCOPe 2.06: d1z94f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z94A (A:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94A (A:)
    pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
    gqkhafggrylelvpgerirytdrfddagdmittitlaplscgadlsivqegipdaippe
    ncylgwqqslkqlaalvepd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z94B (B:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94B (B:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z94C (C:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94C (C:)
    pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
    gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
    ppencylgwqqslkqlaalvepd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z94D (D:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94D (D:)
    pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
    gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
    ppencylgwqqslkqlaalvepd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z94E (E:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94E (E:)
    pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
    gqkhafggrylelvpgerirytdrfdgdmittitlaplscgadlsivqegipdaippenc
    ylgwqqslkqlaalvepd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z94F (F:)
    mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
    sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
    ippencylgwqqslkqlaalvepdmpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z94F (F:)
    pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
    gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
    ppencylgwqqslkqlaalvepd