PDB entry 1z91

View 1z91 on RCSB PDB site
Description: x-ray crystal structure of apo-OhrRC15S in reduced form: MarR family protein
Class: DNA binding protein
Keywords: OhrR, MarR family, Bacterial transcription factor, DNA BINDING PROTEIN
Deposited on 2005-03-31, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Organic hydroperoxide resistance transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ohrR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34777
      • engineered (14)
    Domains in SCOPe 2.07: d1z91a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z91A (A:)
    menkfdhmklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkm
    geqlyldsgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilg
    lskqsgedlkqlksalytlletlhqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z91A (A:)
    mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
    sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
    dlkqlksalytlletlh