PDB entry 1z90

View 1z90 on RCSB PDB site
Description: X-ray structure of gene product from arabidopsis thaliana at3g03250, a putative UDP-glucose pyrophosphorylase
Class: structural genomics, unknown function
Keywords: at3g03250, putative udp-glucose pyrophosphorylase, structural genomics, protein structure initiative, psi, cesg, center for eukaryotic structural genomics
Deposited on 2005-03-31, released 2005-04-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AT3g03250 protein
    Species: Arabidopsis thaliana
    Gene: AT3G03250
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z90a1, d1z90a2
  • Chain 'B':
    Compound: AT3g03250 protein
    Species: Arabidopsis thaliana
    Gene: AT3G03250
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z90b1, d1z90b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z90A (A:)
    maattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z90A (A:)
    enlpqlksavdgltemseseksgfislvsrylsgiewskiqtptdeivvpyekmtpvsqd
    vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
    plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
    pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
    ktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklve
    adalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvq
    sdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvw
    fgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z90B (B:)
    maattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z90B (B:)
    lpqlksavdgltemseseksgfislvsryliewskiqtptdeivvpyekmtpvsqdvaet
    knlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckvplvl
    mnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyppghg
    dvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtpktla
    dvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklveadal
    kmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqsdly
    tlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgss
    ivlkgkvtvaaksgvkleipdravvenkningped