PDB entry 1z8y
View 1z8y on RCSB PDB site
Description: Mapping the E2 Glycoprotein of Alphaviruses
Class: Virus
Keywords: icosahedral enveloped virus, cryo-electron microscopy, Icosahedral virus
Deposited on
2005-03-31, released
2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-06.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: Spike glycoprotein E2
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Spike glycoprotein E2
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: Spike glycoprotein E2
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: Spike glycoprotein E1
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: Spike glycoprotein E2
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: capsid protein c
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1z8yq1 - Chain 'R':
Compound: capsid protein c
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1z8yr1 - Chain 'S':
Compound: capsid protein c
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1z8ys1 - Chain 'T':
Compound: capsid protein c
Species: Sindbis virus [TaxId:11034]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1z8yt1
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.
- Chain 'Q':
Sequence; same for both SEQRES and ATOM records: (download)
>1z8yQ (Q:)
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew
- Chain 'R':
Sequence; same for both SEQRES and ATOM records: (download)
>1z8yR (R:)
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew
- Chain 'S':
Sequence; same for both SEQRES and ATOM records: (download)
>1z8yS (S:)
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew
- Chain 'T':
Sequence; same for both SEQRES and ATOM records: (download)
>1z8yT (T:)
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew