PDB entry 1z8y

View 1z8y on RCSB PDB site
Description: Mapping the E2 Glycoprotein of Alphaviruses
Class: virus
Keywords: icosahedral enveloped virus, Icosahedral virus, Virus
Deposited on 2005-03-31, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Spike glycoprotein E2
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11259 (0-35)
      • see remark 999 (28)
  • Chain 'K':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Spike glycoprotein E2
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11259 (0-35)
      • see remark 999 (28)
  • Chain 'M':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Spike glycoprotein E2
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11259 (0-35)
      • see remark 999 (28)
  • Chain 'O':
    Compound: Spike glycoprotein E1
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Spike glycoprotein E2
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11259 (0-35)
      • see remark 999 (28)
  • Chain 'Q':
    Compound: capsid protein c
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z8yq1
  • Chain 'R':
    Compound: capsid protein c
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z8yr1
  • Chain 'S':
    Compound: capsid protein c
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z8ys1
  • Chain 'T':
    Compound: capsid protein c
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z8yt1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8yQ (Q:)
    rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
    rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
    adegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8yR (R:)
    rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
    rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
    adegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8yS (S:)
    rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
    rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
    adegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8yT (T:)
    rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
    rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
    adegtrtalsvvtwnskgktikttpegteew