PDB entry 1z8s

View 1z8s on RCSB PDB site
Description: DnaB binding domain of DnaG (P16) from Bacillus stearothermophilus (residues 452-597)
Deposited on 2005-03-31, released 2005-10-04
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: dnaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4D0 (0-145)
      • engineered (0)
      • see remark 999 (78-79)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z8sA (A:)
    makkllpafqnaerlllahmmrsrdvalvvqeriggrfnieehralaayiyafyeeghea
    dpgalisripgelqplaselsllliaddvseqeledyirhvlnrpkwlmlkvkeqektea
    errkdfltaariakemiemkkmlsss