PDB entry 1z8r

View 1z8r on RCSB PDB site
Description: 2A cysteine proteinase from human coxsackievirus B4 (strain JVB / Benschoten / New York / 51)
Class: hydrolase
Keywords: beta barrel coordinated zinc ion, HYDROLASE
Deposited on 2005-03-31, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coxsackievirus B4 polyprotein
    Species: Human coxsackievirus B4 [TaxId:12073]
    Gene: picornain 2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08292 (Start-165)
      • engineered (125)
    Domains in SCOPe 2.07: d1z8ra_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8rA (A:)
    mahhhhhheraslittgpyghqsgavyvgnykvvnrhlathvdwqncvwedynrdllvst
    ttahgcdtiarcqcttgvyfcaskskhypvsfegpglvevqeseyypkryqshvllatgf
    sepgdaggilrcehgviglvtmggegvvgfadvrdllwleddameq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8rA (A:)
    gpyghqsgavyvgnykvvnrhlathvdwqncvwedynrdllvstttahgcdtiarcqctt
    gvyfcaskskhypvsfegpglvevqeseyypkryqshvllatgfsepgdaggilrcehgv
    iglvtmggegvvgfadvrdllwleddameq