PDB entry 1z8o

View 1z8o on RCSB PDB site
Description: Ferrous dioxygen complex of the wild-type cytochrome P450eryF
Class: oxidoreductase
Keywords: heme, cyp, P450, erythromycin, OXIDOREDUCTASE
Deposited on 2005-03-31, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-deoxyerythronolide B hydroxylase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryF, CYP107A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z8oa_
  • Heterogens: HEM, OXY, DEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8oA (A:)
    mttvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssd
    pkkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrpr
    veqitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdpe
    raeqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvlll
    agfeasvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeeve
    iggvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplakle
    gevalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8oA (A:)
    tvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdpk
    kkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprve
    qitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdpera
    eqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvlllag
    feasvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeeveig
    gvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplaklege
    valralfgrfpalslgidaddvvwrrslllrgidhlpvrldg