PDB entry 1z8l

View 1z8l on RCSB PDB site
Description: Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
Class: hydrolase
Keywords: Dimeric protein with three domains of type A+B
Deposited on 2005-03-30, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.252
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase II
    Species: HOMO SAPIENS
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z8la1, d1z8la2, d1z8la3
  • Chain 'B':
    Compound: glutamate carboxypeptidase II
    Species: HOMO SAPIENS
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z8lb1, d1z8lb2, d1z8lb3
  • Chain 'C':
    Compound: glutamate carboxypeptidase II
    Species: HOMO SAPIENS
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z8lc1, d1z8lc2, d1z8lc3
  • Chain 'D':
    Compound: glutamate carboxypeptidase II
    Species: HOMO SAPIENS
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z8ld1, d1z8ld2, d1z8ld3
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8lA (A:)
    hnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydv
    llsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlv
    yvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyf
    apgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvh
    pigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtri
    ynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrt
    ilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvh
    nltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgra
    rytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpf
    dcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdk
    snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
    eskvdpskawgevkrqiyvaaftvqaaaetlseva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8lB (B:)
    hnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydv
    llsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlv
    yvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyf
    apgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvh
    pigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtri
    ynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrt
    ilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvh
    nltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgra
    rytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpf
    dcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdk
    snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
    eskvdpskawgevkrqiyvaaftvqaaaetlseva
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8lC (C:)
    hnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydv
    llsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlv
    yvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyf
    apgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvh
    pigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtri
    ynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrt
    ilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvh
    nltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgra
    rytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpf
    dcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdk
    snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
    eskvdpskawgevkrqiyvaaftvqaaaetlseva
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z8lD (D:)
    hnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydv
    llsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlv
    yvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyf
    apgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvh
    pigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtri
    ynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrt
    ilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvh
    nltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgra
    rytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpf
    dcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdk
    snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
    eskvdpskawgevkrqiyvaaftvqaaaetlseva