PDB entry 1z8k

View 1z8k on RCSB PDB site
Description: X-ray structure of allene oxide cyclase from Arabidopsis thaliana at3g25770
Class: isomerase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT3G25770, Center for Eukaryotic Structural Genomics, jasmonic acid biosynthesis, plant protein, ISOMERASE
Deposited on 2005-03-30, released 2005-04-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.15
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At3g25770 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.05: d1z8ka1
  • Chain 'B':
    Compound: At3g25770 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.05: d1z8kb_
  • Chain 'C':
    Compound: At3g25770 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.05: d1z8kc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8kA (A:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8kA (A:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z8kB (B:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8kB (B:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z8kC (C:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8kC (C:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn