PDB entry 1z8j

View 1z8j on RCSB PDB site
Description: crystal structure of the thrombin mutant g193p bound to ppack
Deposited on 2005-03-30, released 2005-05-17
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (202)
  • Heterogens: ZN, 0G6, NAG, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z8jA (A:)
    tffnprtfgsgeadcglrplfekksledkterellesyid
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z8jB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacepdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records):
    >1z8jB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhrniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdreta
    asllqagykgrvtgwgnlketqpsvlqvvnlpiverpvckdstriritdnmfcagykpde
    gkrgdacepdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi
    dqf