PDB entry 1z8h

View 1z8h on RCSB PDB site
Description: Crystal structure of Putative lipase from the G-D-S-L family (17135349) from NOSTOC SP. PCC 7120 at 2.02 A resolution
Class: structural genomics, unknown function
Keywords: 17135349, putative lipase from the G-D-S-L family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-04-11, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative lipase from the G-D-S-L family
    Species: Anabaena sp.
    Gene: ALR1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YWS4 (Start-217)
      • modified residue (133)
    Domains in SCOP 1.73: d1z8ha1
  • Chain 'B':
    Compound: putative lipase from the G-D-S-L family
    Species: Anabaena sp.
    Gene: ALR1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YWS4
      • modified residue (133)
    Domains in SCOP 1.73: d1z8hb1
  • Chain 'C':
    Compound: putative lipase from the G-D-S-L family
    Species: Anabaena sp.
    Gene: ALR1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YWS4
      • modified residue (133)
    Domains in SCOP 1.73: d1z8hc1
  • Chain 'D':
    Compound: putative lipase from the G-D-S-L family
    Species: Anabaena sp.
    Gene: ALR1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YWS4 (Start-217)
      • modified residue (133)
    Domains in SCOP 1.73: d1z8hd1
  • Heterogens: UNL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8hA (A:)
    mgsdkihhhhhhmtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyy
    nlgirrdtssdiakrwlqevslrlhkeynslvvfsfglndttlengkprvsiaetikntr
    eiltqakklypvlmispapyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekp
    svwlheakandgvhpqaggytefarivenwdawlnwfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8hA (A:)
    sktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrw
    lqevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmis
    papyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpq
    aggytefarivenwdawlnwfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z8hB (B:)
    mgsdkihhhhhhmtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyy
    nlgirrdtssdiakrwlqevslrlhkeynslvvfsfglndttlengkprvsiaetikntr
    eiltqakklypvlmispapyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekp
    svwlheakandgvhpqaggytefarivenwdawlnwfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8hB (B:)
    tqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlq
    evslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispa
    pyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqag
    gytefarivenwdawlnwf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z8hC (C:)
    mgsdkihhhhhhmtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyy
    nlgirrdtssdiakrwlqevslrlhkeynslvvfsfglndttlengkprvsiaetikntr
    eiltqakklypvlmispapyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekp
    svwlheakandgvhpqaggytefarivenwdawlnwfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8hC (C:)
    ktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwl
    qevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmisp
    apyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqa
    ggytefarivenwdawlnwf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z8hD (D:)
    mgsdkihhhhhhmtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyy
    nlgirrdtssdiakrwlqevslrlhkeynslvvfsfglndttlengkprvsiaetikntr
    eiltqakklypvlmispapyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekp
    svwlheakandgvhpqaggytefarivenwdawlnwfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8hD (D:)
    ktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwl
    qevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmisp
    apyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqa
    ggytefarivenwdawlnwfr