PDB entry 1z8g

View 1z8g on RCSB PDB site
Description: Crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease hepsin, protease, hydrolase-hydrolase inhibitor complex
Deposited on 2005-03-30, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.196
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPN, TMPRSS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05981 (Start-371)
      • engineered (66)
    Domains in SCOPe 2.07: d1z8ga1, d1z8ga2
  • Chain 'L':
    Compound: ACE-LYS-GLN-LEU-ARG-Chloromethylketone
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z8G (Start-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8gA (A:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklpvdrivg
    grdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagavaqa
    sphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaagqal
    vdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypegg
    idacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaik
    thseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8gA (A:)
    eplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrt
    agaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklpivggrdtsl
    grwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagavaqasphglq
    lgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaagqalvdgkic
    tvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidacqg
    dsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthseas
    gmvtql
    

  • Chain 'L':
    No sequence available.