PDB entry 1z8f

View 1z8f on RCSB PDB site
Description: Guanylate Kinase Double Mutant A58C, T157C from Mycobacterium tuberculosis (Rv1389)
Class: transferase
Keywords: ATP:GMP-PHOSPHOTRANSFERASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, TB STRUCTURAL GENOMICS CONSORTIUM, TBSGC, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, TRANSFERASE
Deposited on 2005-03-30, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gmk
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5I4
      • engineered (59)
      • engineered (158)
    Domains in SCOPe 2.07: d1z8fa_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8fA (A:)
    mavsvgegpdtkptargqpaavgrvvvlsgpsavgkstvvrclreripnlhfsvsattrc
    prpgevdgvdyhfidptrfqqlidqgellewaeihgglhrsgtlaqpvraaaatgvpvli
    evdlagaraikktmpeavtvflappswqdlqarligrgcetadviqrrldtarielaaqg
    dfdkvvvnrrlesacaelvsllvgtapgspgvprgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8fA (A:)
    avgrvvvlsgpsavgkstvvrclreripnlhfsvsattrcprpgevdgvdyhfidptrfq
    qlidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtv
    flappswqdlqarligrgcetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvs
    llvg