PDB entry 1z8d

View 1z8d on RCSB PDB site
Description: Crystal Structure of Human Muscle Glycogen Phosphorylase a with AMP and Glucose
Class: transferase
Keywords: transferase
Deposited on 2005-03-30, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11217
      • engineered (14)
      • engineered (680)
    Domains in SCOPe 2.07: d1z8da_
  • Heterogens: GLC, AMP, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z8dA (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkisggwqmeea
    ddwlrygnpwekarpeftlpvhfyghvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrilvdlerm
    dwdkawdvtvrtcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeviaerigedfisdldqlrkllsfvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdiqvkriheykrqllnclhvitlynrikrepnkffv
    prtvmiggkaapgyhmakmiirlvtaigdvvnhdpavgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    kldqrgynaqeyydripelrqvieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyed
    yikcqekvsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    ai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z8dA (A:)
    rplsdqekrkqisvrgvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkisggwqmeeaddwlr
    ygnpwekarpeftlpvhfyghvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssk
    fgcrdpvrtnfdafpdkvaiqlndthpslaipelmrilvdlermdwdkawdvtvrtcayt
    nhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveega
    vkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlc
    npglaeviaerigedfisdldqlrkllsfvddeafirdvakvkqenklkfaaylereykv
    hinpnslfdiqvkriheykrqllnclhvitlynrikrepnkffvprtvmiggkaapgyhm
    akmiirlvtaigdvvnhdpavgdrlrviflenyrvslaekvipaadlseqistagteasg
    tgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdkldqrgynaqeyydri
    pelrqvieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyedyikcqekvsalyknpr
    ewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa