PDB entry 1z88

View 1z88 on RCSB PDB site
Description: Crystal structure of Lys154Arg mutant of mature AphA of S. typhimurium
Class: hydrolase
Keywords: Class-B bacterial acid phosphatase, Lys154Arg mutant of mature AphA, metalloenzyme, HYDROLASE
Deposited on 2005-03-30, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d1z88a1
  • Chain 'B':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d1z88b_
  • Chain 'C':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d1z88c_
  • Chain 'D':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58683 (Start-213)
      • engineered (153)
    Domains in SCOPe 2.07: d1z88d_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z88A (A:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z88A (A:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z88B (B:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z88B (B:)
    stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
    spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
    ktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgirgi
    rilraanstykplpqagafgeevivnsey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z88C (C:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z88C (C:)
    stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
    spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
    ktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgirgi
    rilraanstykplpqagafgeevivnsey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z88D (D:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z88D (D:)
    spstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkk
    tyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktet
    vsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgir
    girilraanstykplpqagafgeevivnsey