PDB entry 1z87

View 1z87 on RCSB PDB site
Description: solution structure of the split PH-PDZ Supramodule of alpha-Syntrophin
Deposited on 2005-03-30, released 2006-01-24
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1-syntrophin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z87A (A:)
    asgrraprtgllelrcgagsgaggerwqrvllslaedaltvspadgepgpepepaqlnga
    aepgaappqlpealllqrrrvtvrkadagglgisikggrenkmpiliskifkglaadqte
    alfvgdailsvngedlssathdeavqalkktgkevvlevkymkevspyfknsaggtsvgw
    dsppasplqrqpsspgpqprnlseakhvslkmayvsrrctptdpepryleicaadgqdav
    flrakdeasarswagaiqaqigt