PDB entry 1z86

View 1z86 on RCSB PDB site
Description: Solution structure of the PDZ domain of alpha-syntrophin
Class: protein binding
Keywords: two alpha helix, six beta strands, PROTEIN BINDING
Deposited on 2005-03-30, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1-syntrophin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z86a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z86A (A:)
    rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls
    sathdeavqalkktgkevvlevkymke