PDB entry 1z85

View 1z85 on RCSB PDB site
Description: Crystal structure of a predicted rna methyltransferase (tm1380) from thermotoga maritima msb8 at 2.12 A resolution
Deposited on 2005-03-29, released 2005-04-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1380
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1A0 (Start-233)
      • modified residue (35)
  • Chain 'B':
    Compound: hypothetical protein TM1380
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1A0 (Start-233)
      • modified residue (35)
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z85A (A:)
    mgsdkihhhhhhmphlfygtaqngevifdereahhmrvvrlkegdvieatdgngfsytci
    lkslkkktaaakivkveekekepteklsvvvpigrwertrfliekcvelgvdeiffhkfe
    rsqheisldkakivvreaakqckrylfpkvsfleklefsgnvitldldasqnlldanleg
    sitvvvgpeggfsekerellrssttivslgkkilrfetaailtvgyialkkqki
    

    Sequence, based on observed residues (ATOM records):
    >1z85A (A:)
    phlfygtaqngevifdereahhmrvvrlkegdvieatdgngfsytcilkslkkktaaaki
    vkveekekepteklsvvvpigrwertrfliekcvelgvdeiffhkfersqheisldkaki
    vvreaakqckrylfpkvsfleklefsgnvitldlqnlldanlegsitvvvgpeggfseke
    rellrssttivlrfetaailtvgyialkkqki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z85B (B:)
    mgsdkihhhhhhmphlfygtaqngevifdereahhmrvvrlkegdvieatdgngfsytci
    lkslkkktaaakivkveekekepteklsvvvpigrwertrfliekcvelgvdeiffhkfe
    rsqheisldkakivvreaakqckrylfpkvsfleklefsgnvitldldasqnlldanleg
    sitvvvgpeggfsekerellrssttivslgkkilrfetaailtvgyialkkqki
    

    Sequence, based on observed residues (ATOM records):
    >1z85B (B:)
    phlfygtaqngevifdereahhmrvvrlkegdvieatdgngfsytcilkslkkktaaaki
    vkveekekepteklsvvvpigrwertrfliekcvelgvdeiffhkfersqheisldkaki
    vvreaakqckrylfpkvsfleklefsgnvitldldasqnlldanlegsitvvvgpeggfs
    ekerellrssttivilrfetaailtvgyialkkqki