PDB entry 1z82

View 1z82 on RCSB PDB site
Description: Crystal structure of glycerol-3-phosphate dehydrogenase (TM0378) from THERMOTOGA MARITIMA at 2.00 A resolution
Class: oxidoreductase
Keywords: TM0378, glycerol-3-phosphate dehydrogenase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, OXIDOREDUCTASE
Deposited on 2005-03-29, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0378
    Database cross-references and differences (RAF-indexed):
    • GB NP_228189
      • modified residue (14)
      • modified residue (31)
      • modified residue (105)
      • modified residue (226)
      • modified residue (236)
      • modified residue (245)
      • modified residue (289)
      • modified residue (299)
      • modified residue (319)
      • modified residue (323)
    Domains in SCOPe 2.08: d1z82a1, d1z82a2
  • Chain 'B':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0378
    Database cross-references and differences (RAF-indexed):
    • GB NP_228189
      • modified residue (14)
      • modified residue (31)
      • modified residue (105)
      • modified residue (226)
      • modified residue (236)
      • modified residue (245)
      • modified residue (289)
      • modified residue (299)
      • modified residue (319)
      • modified residue (323)
    Domains in SCOPe 2.08: d1z82b1, d1z82b2
  • Heterogens: NDP, G3H, G3P, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z82A (A:)
    mgsdkihhhhhhmemrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtsp
    yveeskitvratndleeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgk
    rvseiveeilgcpyavlsgpshaeevakklptavtlagenskelqkristeyfrvytced
    vvgveiagalknviaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmgla
    gigdlmvtcnsrysrnrrfgeliargfnplkllessnqvvegaftvkavmkiakenkidm
    piseevyrvvyegkpplqsmrdlmrrslkdefwas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z82A (A:)
    emrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtspyveeskitvratn
    dleeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgkrvseiveeilgcp
    yavlsgpshaeevakklptavtlagenskelqkristeyfrvytcedvvgveiagalknv
    iaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmglagigdlmvtcnsry
    srnrrfgeliargfnplkllessnqvvegaftvkavmkiakenkidmpiseevyrvvyeg
    kpplqsmrdlmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z82B (B:)
    mgsdkihhhhhhmemrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtsp
    yveeskitvratndleeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgk
    rvseiveeilgcpyavlsgpshaeevakklptavtlagenskelqkristeyfrvytced
    vvgveiagalknviaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmgla
    gigdlmvtcnsrysrnrrfgeliargfnplkllessnqvvegaftvkavmkiakenkidm
    piseevyrvvyegkpplqsmrdlmrrslkdefwas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z82B (B:)
    mrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtspyveeskitvratnd
    leeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgkrvseiveeilgcpy
    avlsgpshaeevakklptavtlagenskelqkristeyfrvytcedvvgveiagalknvi
    aiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmglagigdlmvtcnsrys
    rnrrfgeliargfnplkllessnqvvegaftvkavmkiakenkidmpiseevyrvvyegk
    pplqsmrdlmrr