PDB entry 1z81

View 1z81 on RCSB PDB site
Description: Crystal Structure of cyclophilin from Plasmodium yoelii.
Class: isomerase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, ISOMERASE
Deposited on 2005-03-29, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.257
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin
    Species: Plasmodium yoelii yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z81a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z81A (A:)
    mgsshhhhhhssglvprgsmksnskdsenkkvenlvlddndentiipyylsnlltnpsnp
    vvfmdinlgnnflgkfkfelfqnivpktsenfrqfctgeykvnnlpvgykntifhrvike
    fmiqggdfinhngsgslsiygekfddenfdikhdkegllsmansgpntngcqffittkkc
    ewldgknvvfgriidndsllllkkienvsvtpyiykpkipinvvecgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z81A (A:)
    tiipyylsnlltnpsnpvvfmdinlgnnflgkfkfelfqnivpktsenfrqfctgeykvn
    nlpvgykntifhrvikefmiqggdfinhngsgslsiygekfddenfdikhdkegllsman
    sgpntngcqffittkkcewldgknvvfgriidndsllllkkienvsvtpyiykpkipinv
    vecgel