PDB entry 1z7z

View 1z7z on RCSB PDB site
Description: Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi
Class: Virus/Receptor
Keywords: ICAM-1,Kilifi,CD54,Human Coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, Icosahedral virus
Deposited on 2005-03-28, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: EM
Resolution: 8 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21
    Database cross-references and differences (RAF-indexed):
    • GB AAQ02684 (Start-285)
  • Chain '2':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21
    Database cross-references and differences (RAF-indexed):
    • GB AAQ02684 (Start-271)
  • Chain '3':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21
    Database cross-references and differences (RAF-indexed):
    • GB AAQ02684 (Start-233)
  • Chain '4':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21
    Database cross-references and differences (RAF-indexed):
    • GB AAQ02684 (0-11)
  • Chain '5':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21
    Database cross-references and differences (RAF-indexed):
    • GB AAQ02684 (0-End)
  • Chain 'I':
    Compound: intercellular adhesion molecule-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05362 (0-449)
      • engineered (28)
    Domains in SCOP 1.73: d1z7zi1, d1z7zi2, d1z7zi3, d1z7zi4, d1z7zi5
  • Heterogens: NAG, NDG

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1z7zI (I:)
    qtsvspskvilprggsvlvtcstscdqpmllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygn
    dsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegte
    vtvkceahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqt
    relrvlygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtv
    trdlegtylcrarstqgevtrevtvnvlsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7zI (I:)
    qtsvspskvilprggsvlvtcstscdqpmllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygn
    dsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegte
    vtvkceagpraqlllkatpedngrsfscsatlevagqlihknqtrelrvlygprlderdc
    pgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdlegtylcrarstq
    gevtrevtvnvlsp