PDB entry 1z7t

View 1z7t on RCSB PDB site
Description: Solution structure of Bacillus subtilis BLAP apo-form
Deposited on 2005-03-28, released 2006-06-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biotin/Lipoyl Attachment Protein
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z7tA (A:)
    tvsiqmagnlwkvhvkagdqiekgqevailesmkmeipivadrsgivkevkkkegdfvne
    gdvllelsnstq