PDB entry 1z7s

View 1z7s on RCSB PDB site
Description: the crystal structure of coxsackievirus a21
Deposited on 2005-03-28, released 2005-08-02
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21 [TaxId:12069]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21 [TaxId:12069]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21 [TaxId:12069]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: human coxsackievirus A21
    Species: Human coxsackievirus A21 [TaxId:12069]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, MYR, G, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >1z7s1 (1:)
    giedlidtaiknalrvsqppstqsteatsgvnsqevpaltavetgasgqaipsdvvetrh
    vvnyktrsesclesffgraacvtilsltnssksgeekkhfniwnitytdtvqlrrkleff
    tysrfdlemtfvftenypstasgevrnqvyqimyippgaprpsswddytwqsssnpsify
    mygnapprmsipyvgianayshfydgfarvplegentdagdtfyglvsindfgvlavrav
    nrsnphtihtsvrvymkpkhircwcprppravlyrgegvdmissailpltkvdsittf
    

    Sequence, based on observed residues (ATOM records):
    >1z7s1 (1:)
    vsqppstqsteatsgvnsqevpaltavetgasgqaipsdvvetrhvvnyktrsesclesf
    fgraacvtilsltnssksgeekkhfniwnitytdtvqlrrklefftysrfdlemtfvfte
    nypstasgevrnqvyqimyippgaprpsswddytwqsssnpsifymygnapprmsipyvg
    ianayshfydgfarvplegentdagdtfyglvsindfgvlavravnrsnphtihtsvrvy
    mkpkhircwcprppravlyrgegvdmissailpltkvdsittf
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1z7s2 (2:)
    spnveacgysdrvrqitlgnstittqeaanaivaygewptyindseanpvdaptepdvss
    nrfytlesvswkttsrgwwwklpdclkdmgmfgqnmyyhylgrsgytihvqcnaskfhqg
    algvflipefvmacntesktsyvsyinanpgerggeftntynpsntdasegrkfaaldyl
    lgsgvlagnafvyphqiinlrtnnsativvpyvnslvidcmakhnnwgivilplaplafa
    atsspqvpitvtiapmctefnglrnitvpvhq
    

    Sequence, based on observed residues (ATOM records):
    >1z7s2 (2:)
    acgysdrvrqitlgnstittqeaanaivaygewptyindseanpvdaptepdvssnrfyt
    lesvswkttsrgwwwklpdclkdmgmfgqnmyyhylgrsgytihvqcnaskfhqgalgvf
    lipefvmacntesktsyvsyinanpgerggeftntynpsntdasegrkfaaldyllgsgv
    lagnafvyphqiinlrtnnsativvpyvnslvidcmakhnnwgivilplaplafaatssp
    qvpitvtiapmctefnglrnitvpvhq
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1z7s3 (3:)
    glptmntpgsnqfltsddfqspcalpnfdvtppihipgevknmmelaeidtlipmnavdg
    kvntmemyqiplndnlskapifclslspasdkrlshtmlgeilnyythwtgsirftflfc
    gsmmatgklllsysppgakpptnrkdamlgthiiwdlglqsscsmvapwisntvyrrcar
    ddfteggfitcfyqtrivvpastptsmfmlgfvsacpdfsvrllkdtphisqskligrtq
    

    Sequence, based on observed residues (ATOM records):
    >1z7s3 (3:)
    glptmntpgsnqfltsddfqspcalpnfdvtppihipgevknmmelaeidtlipmnavdg
    kvntmemyqiplndnlskapifclslspasdkrlshtmlgeilnyythwtgsirftflfc
    gsmmatgklllsysppgakpptnrkdamlgthiiwdlglqsscsmvapwisntvyrrcar
    ddfteggfitcfyqtrivvpastptsmfmlgfvsacpdfsvrllkdtphisqskligrt
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records:
    >1z7s4 (4:)
    gaqvstqktgahenqnvaangstinyttinyykdsasnsatrqdlsqdpskftepvkdlm
    lktapaln