PDB entry 1z7r

View 1z7r on RCSB PDB site
Description: solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides
Deposited on 2005-03-26, released 2006-03-28
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Populus tremula x Populus tremuloides [TaxId:47664]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5PSJ1 (2-111)
      • cloning artifact (0-1)
      • see remark 999 (112-116)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z7rA (A:)
    maskqeldaalkkakelassapvvvfsktycgycnrvkqlltqvgasykvveldelsdgs
    qlqsalahwtgrgtvpnvfiggkqiggcdtvvekhqrnellpllqdaaataknpaql