PDB entry 1z7m

View 1z7m on RCSB PDB site
Description: ATP Phosphoribosyl transferase (HisZG ATP-PRTase) from Lactococcus lactis
Class: Transferase
Keywords: ATP-PRT, histidine biosynthesis, transferase, HisZG, allosteric, evolution
Deposited on 2005-03-25, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: hisZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7ma1
  • Chain 'B':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: hisZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7mb_
  • Chain 'C':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: hisZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7mc_
  • Chain 'D':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: hisZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7md_
  • Chain 'E':
    Compound: ATP phosphoribosyltransferase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: HISG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7me1
  • Chain 'F':
    Compound: ATP phosphoribosyltransferase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: HISG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7mf_
  • Chain 'G':
    Compound: ATP phosphoribosyltransferase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: HISG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7mg_
  • Chain 'H':
    Compound: ATP phosphoribosyltransferase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: HISG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7mh_
  • Heterogens: PO4, WO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7mA (A:)
    mrgshhhhhhgsiegrmekinyllpeesaemtlnqvkslrqiegrlrklfslknyqevmp
    psfeytqlytalesngktfnqekmfqfikhegqsitlrydftlplvrlysqikdstsary
    syfgkifrkekrhkgrstenyqigielfgesadkseleilslalqvieqlglnktvfeig
    sakffqrlcqladgstelltelllkkdlsglnafieknnfskelrgllkeifitnelsrl
    enlvtntkddvlissfdqlkefseklsmikpiiidlgmvpkmdyytdlmfkayssaanqp
    ilsggrydqllsnfqeeafaigfcchmdtilkalerqeleednd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mA (A:)
    yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq
    ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekenyqigielf
    gesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstelltelllkkdl
    sglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlkefseklsm
    ikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafaigfcchmd
    tilkalerqel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z7mB (B:)
    mrgshhhhhhgsiegrmekinyllpeesaemtlnqvkslrqiegrlrklfslknyqevmp
    psfeytqlytalesngktfnqekmfqfikhegqsitlrydftlplvrlysqikdstsary
    syfgkifrkekrhkgrstenyqigielfgesadkseleilslalqvieqlglnktvfeig
    sakffqrlcqladgstelltelllkkdlsglnafieknnfskelrgllkeifitnelsrl
    enlvtntkddvlissfdqlkefseklsmikpiiidlgmvpkmdyytdlmfkayssaanqp
    ilsggrydqllsnfqeeafaigfcchmdtilkalerqeleednd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mB (B:)
    yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq
    ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny
    qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte
    lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke
    fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai
    gfcchmdtilkalerqel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z7mC (C:)
    mrgshhhhhhgsiegrmekinyllpeesaemtlnqvkslrqiegrlrklfslknyqevmp
    psfeytqlytalesngktfnqekmfqfikhegqsitlrydftlplvrlysqikdstsary
    syfgkifrkekrhkgrstenyqigielfgesadkseleilslalqvieqlglnktvfeig
    sakffqrlcqladgstelltelllkkdlsglnafieknnfskelrgllkeifitnelsrl
    enlvtntkddvlissfdqlkefseklsmikpiiidlgmvpkmdyytdlmfkayssaanqp
    ilsggrydqllsnfqeeafaigfcchmdtilkalerqeleednd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mC (C:)
    yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytanqekmfqfik
    hegqsitlrydftlplvrlysqikdstsarysyfgkifrkeenyqigielfgesadksel
    eilslalqvieqlglnktvfeigsakffqrlcqladgstelltelllkkdlsglnafiek
    nnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlkefseklsmikpiiidlg
    mvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafaigfcchmdtilkalerq
    el
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z7mD (D:)
    mrgshhhhhhgsiegrmekinyllpeesaemtlnqvkslrqiegrlrklfslknyqevmp
    psfeytqlytalesngktfnqekmfqfikhegqsitlrydftlplvrlysqikdstsary
    syfgkifrkekrhkgrstenyqigielfgesadkseleilslalqvieqlglnktvfeig
    sakffqrlcqladgstelltelllkkdlsglnafieknnfskelrgllkeifitnelsrl
    enlvtntkddvlissfdqlkefseklsmikpiiidlgmvpkmdyytdlmfkayssaanqp
    ilsggrydqllsnfqeeafaigfcchmdtilkalerqeleednd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mD (D:)
    yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytaletfnqekmf
    qfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrstenyqigi
    elfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstelltelllk
    kdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlkefsek
    lsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafaigfcc
    hmdtilkalerqel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z7mE (E:)
    mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
    givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv
    tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr
    mivnkssfkfkkdkiiemverledaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mE (E:)
    mikiaitkgriqkqvtkllenadydvepirelqiktkddlqiifgkpndvitflehgivd
    igfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprvtkky
    faqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistrmivn
    kssfkfkkdkiiemverled
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z7mF (F:)
    mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
    givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv
    tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr
    mivnkssfkfkkdkiiemverledaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mF (F:)
    mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
    givdigfvgkdtldendfddyyellylkigqcifalasypdfsnkrhkriaskyprvtkk
    yfaqkqedieiiklesvelgpvvgladaivdivetgntlsangleviekisdistrmivn
    kssfkfkkdkiiemverleda
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1z7mG (G:)
    mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
    givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv
    tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr
    mivnkssfkfkkdkiiemverledaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mG (G:)
    mikiaitkgriqkqvtkllenadydvepilrelqiktkddlqiifgkpndvitflehgiv
    digfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprvtkk
    yfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistrmiv
    nkssfkfkkdkiiemverledaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1z7mH (H:)
    mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
    givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv
    tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr
    mivnkssfkfkkdkiiemverledaqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7mH (H:)
    mikiaitkgriqkqvtkllenadydvepilniktkddlqiifgkpndvitflehgivdig
    fvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprvtkkyfa
    qkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistrmivnks
    sfkfkkdkiiemverleda