PDB entry 1z7l

View 1z7l on RCSB PDB site
Description: Crystal structure of fragment of mouse ubiquitin-activating enzyme
Deposited on 2005-03-25, released 2005-04-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.277
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Mus musculus [TaxId:10090]
    Gene: Ube1x, Uba1, Ube1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Mus musculus [TaxId:10090]
    Gene: Ube1x, Uba1, Ube1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Mus musculus [TaxId:10090]
    Gene: Ube1x, Uba1, Ube1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TBR

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z7lA (A:)
    mghhhhhhefeksipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfver
    tlrlagtqplevleavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqlt
    ssgapfwsgpkrcphpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvq
    vpeftpksgvkihvsdqelqsanasvddsrleelkatlpspdklpgfkmypidfekddds
    nfhmdfivaasnlraenydispadrhkskliagkii
    

    Sequence, based on observed residues (ATOM records):
    >1z7lA (A:)
    ipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfvertlrlagtqplevl
    eavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqltssgapfwsgpkrc
    phpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvqvpeftpksgvkih
    vsdqelvddsrleelkatlpspdklpgfkmypidfekdddsnfhmdfivaasnlraenyd
    ispadrhkskliagk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z7lB (B:)
    mghhhhhhefeksipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfver
    tlrlagtqplevleavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqlt
    ssgapfwsgpkrcphpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvq
    vpeftpksgvkihvsdqelqsanasvddsrleelkatlpspdklpgfkmypidfekddds
    nfhmdfivaasnlraenydispadrhkskliagkii
    

    Sequence, based on observed residues (ATOM records):
    >1z7lB (B:)
    ipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfvertlrlagtqplevl
    eavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqltssgapfwsgpkrc
    phpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvqvpeftpksgvkih
    vsdqelvddsrleelkatlpspdklpgfkmypidfekdddsnfhmdfivaasnlraenyd
    ispadrhkskliagk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1z7lC (C:)
    mghhhhhhefeksipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfver
    tlrlagtqplevleavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqlt
    ssgapfwsgpkrcphpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvq
    vpeftpksgvkihvsdqelqsanasvddsrleelkatlpspdklpgfkmypidfekddds
    nfhmdfivaasnlraenydispadrhkskliagkii
    

    Sequence, based on observed residues (ATOM records):
    >1z7lC (C:)
    ipictlknfpnaiehtlqwardefeglfkqpaenvnqyltdskfvertlrlagtqplevl
    eavqrslvlqrpqtwgdcvtwachhwhtqycnnirqllhnfppdqltssgapfwsgpkrc
    phpltfdvnntlhldyvmaaanlfaqtygltgsqdraavasllqsvqvpeftpksgvkih
    vsdqelvddsrleelkatlpspdklpgfkmypidfekdddsnfhmdfivaasnlraenyd
    ispadrhkskliagk